Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cytochrome o ubiquinol oxidase subunit 3(cyoC)

Recombinant Cytochrome o ubiquinol oxidase subunit 3(cyoC)

SKU:CSB-CF364659SZB

Regular price £1,276.00 GBP
Regular price Sale price £1,276.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P0ABJ5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFATYAVLVNGTAGGPTG KDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLALTWLFGAGFIGMEIYEF HHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQIARRGLTSTNRTRIMCL SLFWHFLDVVWICVFTVVYLMGAM

Protein Names:Recommended name: Cytochrome o ubiquinol oxidase subunit 3 EC= 1.10.3.- Alternative name(s): Cytochrome o ubiquinol oxidase subunit III Ubiquinol oxidase chain C

Gene Names:Name:cyoC Ordered Locus Names:SF0371, S0376

Expression Region:1-204

Sequence Info:full length protein

View full details