
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:P24891
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFHNFHILSLSSYAYNLFFASAGMLSSLVMFFKFGLYELFIFTLFSVLFISFAWGKDIAM EGLSGYHNFFVMDGFKFGVILFVFSEFMFFFCIFCTFFDAALVPVHELGETWSPFGMHLV NPFGVPLLNTIILLSSGVTVTWAHHSLLSNKSCTNSMILTCLLAAYFTGIQLMEYMEASF SIADGVFGSIFYLSTGFHGIHVLCGGLFLAFNFLRLLKNHFNYNHHLGLEFAILYWHFVD VVWLFLFVFVYWWSY
Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III
Gene Names:Name:cox-3 Synonyms:coIII ORF Names:MTCE.23
Expression Region:1-255
Sequence Info:full length protein
You may also like
-
Recombinant Cytochrome c oxidase subunit 3(COX3)
- Regular price
- £1,210.00 GBP
- Sale price
- £1,210.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 3(COX3)
- Regular price
- £1,203.00 GBP
- Sale price
- £1,203.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 3(COX3)
- Regular price
- £1,212.00 GBP
- Sale price
- £1,212.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 3(COX3)
- Regular price
- £1,209.00 GBP
- Sale price
- £1,209.00 GBP
- Regular price
-
- Unit price
- per
Sold out