Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cyanothece sp. UPF0059 membrane protein PCC8801_2453 (PCC8801_2453)

Recombinant Cyanothece sp. UPF0059 membrane protein PCC8801_2453 (PCC8801_2453)

SKU:CSB-CF478986EPW

Regular price £1,274.00 GBP
Regular price Sale price £1,274.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cyanothece sp. (strain PCC 8801) (Synechococcus sp. (strain PCC 8801 / RF-1))

Uniprot NO.:B7K3S3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLLNTTFLSIGLAIDAFAVSLSSGFIIKHIKFNKALKIALFFGIFQGVMPLIGWLTGLT FRDALANFDHWIAFILLAAIGGKMIYEACQDEEENKKFNPLDNYTLFALAIATSIDALAA GLGLSVLRVSILLACTLIASITFSLSFIGVFIGHKFGSIFNQKLEILGGITLIGIGTKIL VEGLIIH

Protein Names:Recommended name: UPF0059 membrane protein PCC8801_2453

Gene Names:Ordered Locus Names:PCC8801_2453

Expression Region:1-187

Sequence Info:full length protein

View full details