Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cyanothece sp. UPF0059 membrane protein PCC7424_2187 (PCC7424_2187)

Recombinant Cyanothece sp. UPF0059 membrane protein PCC7424_2187 (PCC7424_2187)

SKU:CSB-CF486565DZZ

Regular price £1,276.00 GBP
Regular price Sale price £1,276.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cyanothece sp. (strain PCC 7424) (Synechococcus sp. (strain ATCC 29155))

Uniprot NO.:B7KGD8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEILTTTFLSLGLAADAFAVSLTSGFSIKHIKLNKALKIALFFGCFQAIMPFIGWSAGLT FRDFISSFDHWIAFGLLSYIGGKMIYESMEEEKEDKKFNPLDSYTLTTLAIATSIDALAA GIGLSVLKGSILLACTLIGFITFGLCFIGVFIGHRFGDILNQKIEIVGGVVLILIGTKIL LEHLGFSLV

Protein Names:Recommended name: UPF0059 membrane protein PCC7424_2187

Gene Names:Ordered Locus Names:PCC7424_2187

Expression Region:1-189

Sequence Info:full length protein

View full details