Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cyanothece sp. ATP synthase subunit a 2(atpB2)

Recombinant Cyanothece sp. ATP synthase subunit a 2(atpB2)

SKU:CSB-CF540306DZY

Regular price £1,310.00 GBP
Regular price Sale price £1,310.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cyanothece sp. (strain ATCC 51142)

Uniprot NO.:B1WUH7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTMLNGLRILDTLPLAALEVGKHWYWEIGNLKLHGQVFMASWVVIALLIIASLLATRNIQ RVPSGMQNFMEYVLEFLRDLARTQLGEKHYRPWLPFIGTLFLFIFVSNWSGSLIPWRLIE IPEGELAAPTNDINTTVALALLTSLAYFYAGLSKKGLGYFANYVQPIPVLLPIKILEDFT KPLSLSFRLFGNILADELVVAVLVFLVPLFVPLPLMALGLFTSAIQALVFATLAGAYIHE AIESEEEEEHA

Protein Names:Recommended name: ATP synthase subunit a 2 Alternative name(s): ATP synthase F0 sector subunit a 2 F-ATPase subunit 6 2

Gene Names:Name:atpB2 Synonyms:atpI2 Ordered Locus Names:cce_4483

Expression Region:1-251

Sequence Info:full length protein

View full details