Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cuscuta obtusiflora ATP synthase subunit C, plastid(atpE)

Recombinant Cuscuta obtusiflora ATP synthase subunit C, plastid(atpE)

SKU:CSB-CF428899CXS

Regular price £1,061.00 GBP
Regular price Sale price £1,061.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Cuscuta obtusiflora (Peruvian dodder)

Uniprot NO.:A8W3H7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPIISAASVIAAGFAVGLASIGPGIGQGTAAGRAVEGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFI

Protein Names:Recommended name: ATP synthase subunit C, plastid Alternative name(s): ATP synthase F0 sector subunit C ATPase subunit III Lipid-binding protein

Gene Names:Name:atpE Synonyms:atpH

Expression Region:1-81

Sequence Info:full length protein

View full details