Gene Bio Systems
Recombinant Cucumis sativus NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic(ndhE)
Recombinant Cucumis sativus NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic(ndhE)
SKU:CSB-CF652405CXP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cucumis sativus (Cucumber)
Uniprot NO.:Q2QD39
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLEHVLIISAYLFSIGIYGLITSRNMVRALMCLELILNAVNMNFVTFSDFFDSRQLKGNI FSIFVIAIAAAEAAIGPAILSSIYRNRKSTRINQSNLLNK
Protein Names:Recommended name: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic EC= 1.6.5.- Alternative name(s): NAD(P)H dehydrogenase subunit 4L NADH-plastoquinone oxidoreductase subunit 4L
Gene Names:Name:ndhE Ordered Locus Names:CsCp107
Expression Region:1-100
Sequence Info:full length protein
