Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cricetulus griseus Lysosome-associated membrane glycoprotein 1(LAMP1)

Recombinant Cricetulus griseus Lysosome-associated membrane glycoprotein 1(LAMP1)

SKU:CSB-CF012738DXU

Regular price £1,452.00 GBP
Regular price Sale price £1,452.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Uniprot NO.:P49129

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASALFVVKDSNGTACIMANFSASFFTIYETGHGSKNSTFELPSSAEVLNSNSSCGRENVSEPILTIAFGSGYLLTLNFTRNATRYSVQDMYFAYNLSDTQHFLNASNKGIHSVDSSTDIKADINKTYRCLSAIQVHMGNVTVTLSDATIQAYLLNSNFSKEETRCTQDGPSPTTVPPSPSPPLVPTNPTVIKYNVTGENGTCLLASMALQMNITYMKKDNMTVTRALNISPNDTASGSCSPHVVTLTVESKNSILDLKFGMNGSSSLFFLQEVRLNMTLPDANVSSLMASNQSLRALQATVGNSYKCNTEEHIFVTKEFSLNVFSVQVQAFKVESDRFGSVEECMQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI

Protein Names:Recommended name: Lysosome-associated membrane glycoprotein 1 Short name= LAMP-1 Short name= Lysosome-associated membrane protein 1 Alternative name(s): CD107 antigen-like family member A Lysosomal membrane glycoprotein A Short name= LGP-A CD_antigen= CD107a

Gene Names:Name:LAMP1 Synonyms:LGPA

Expression Region:22-407

Sequence Info:full length protein

View full details