Skip to product information
1 of 1

Gene Bio Systems

Recombinant Corynebacterium glutamicum UPF0233 membrane protein cgR_0053 (cgR_0053)

Recombinant Corynebacterium glutamicum UPF0233 membrane protein cgR_0053 (cgR_0053)

SKU:CSB-CF391373CXG

Regular price £1,177.00 GBP
Regular price Sale price £1,177.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Corynebacterium glutamicum (strain R)

Uniprot NO.:A4Q9X1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKARVTKNETAPVSSNPSANRTPVKINSAGTPMWYKVIMFAFMIVGLAWLIVNYLVGPQ IPFMADLGAWNYGIGFGLMIIGLLMTMGWR

Protein Names:Recommended name: UPF0233 membrane protein cgR_0053

Gene Names:Ordered Locus Names:cgR_0053

Expression Region:1-90

Sequence Info:full length protein

View full details