Skip to product information
1 of 1

Gene Bio Systems

Recombinant Corylus avellana 2S albuminImported

Recombinant Corylus avellana 2S albuminImported

SKU:CSB-EP2016CBAD

Regular price £873.00 GBP
Regular price Sale price £873.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: D0PWG2

Gene Names: N/A

Organism: Corylus avellana (European hazel) (Corylus maxima)

AA Sequence: FRTTITTVDVDEDIVNQQGRRGESCREQAQRQQNLNQCQRYMRQQSQYGSYDGSNQQQQQELEQCCQQLRQMDERCRCEGLRQAVMQQQGEMRGEEMREVMETARDLPNQCRLSPQRCEIRSARF

Expression Region: 23-147aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 30.9 kDa

Alternative Name(s):

Relevance:

Reference: "Isolation, cloning, and characterization of 2S albumin, a new hazelnut allergen."Garino C., Zuidmeer L., Marsh J., Morati M., Versteeg S., Brettlova V., Schilte P., Shewry P., Arlorio M., van Ree R.Submitted (OCT-2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details