Gene Bio Systems
Recombinant Coprinus comatus Allergen Cop c 5(cop c5)
Recombinant Coprinus comatus Allergen Cop c 5(cop c5)
SKU:CSB-CF892589CPP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coprinus comatus (Shaggy mane)
Uniprot NO.:Q9UW00
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYVAGVSFQQDTMPVLVHRKLEVNHKPPAVKEIVKHLIQVLNPKLHLYLFPVRRNPGYLK FTISLHLFLAHINCIHYSTSKLPSSSTLSSAKRSSISRNSSSSSLSDITMNSSESLPITL SLLSSNIACFLAFSFAFCLAV
Protein Names:Recommended name: Allergen Cop c 5 Alternative name(s): Allergen= Cop c 5
Gene Names:Name:cop c5
Expression Region:1-141
Sequence Info:full length protein
