Skip to product information
1 of 1

Gene Bio Systems

Recombinant Conus striatus Con-ikot-ikot

Recombinant Conus striatus Con-ikot-ikot

SKU:CSB-YP316701DWI

Regular price £876.00 GBP
Regular price Sale price £876.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P0CB20

Gene Names: N/A

Organism: Conus striatus (Striated cone)

AA Sequence: SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA

Expression Region: 38-123aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 11.4 kDa

Alternative Name(s):

Relevance: Potently and selectively blocks the desensitization of ionotropic glutamate AMPA receptor (GRIA1, GRIA2, GRIA3 and GRIA4). Can also open already desensitized GRIA1 receptors. Binds to a different site than does the drug cyclothiazide . The toxin acts like a straightjacket on the ligand-binding domain (LBD) "gating ring" of the receptor, restraining the domains via both intra- and interdimer cross-links such that agonist-induced closure of the LBD "clamshells" is transduced into an irislike expansion of the gating ring . Application of the toxin to hippocampal slices causes a large and rapid increase in resting AMPAR-mediated current leading to neuronal death .

Reference: A novel Conus snail polypeptide causes excitotoxicity by blocking desensitization of AMPA receptors.Walker C.S., Jensen S., Ellison M., Matta J.A., Lee W.Y., Imperial J.S., Duclos N., Brockie P.J., Madsen D.M., Isaac J.T., Olivera B., Maricq A.V.Curr. Biol. 19:900-908(2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details