Gene Bio Systems
Recombinant Coccidioides immitis Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)
Recombinant Coccidioides immitis Vacuolar ATPase assembly integral membrane protein VMA21(VMA21)
SKU:CSB-CF625175DUV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Coccidioides immitis (strain RS) (Valley fever fungus)
Uniprot NO.:Q1DPX9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MATRRNPTKESITTSPPPDQQPRQPGELEHREAIQLRDLPGYPQQVLWKLIIYSIAVLVL PLSAYFYSVNYVFDGNTTYAGATAAITANLILFSYIVVAMREDKGDQEQLREQQQLRGNK EETKKMK
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:VMA21 ORF Names:CIMG_07634
Expression Region:1-127
Sequence Info:full length protein
