
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P04958
Gene Names: tetX
Organism: Clostridium tetani (strain Massachusetts / E88)
AA Sequence: SLLDKFDTNSNSVSFNLLEQDPSGATTKSAMLTNLIIFGPGPVLNKNEVRGIVLRVDNKNYFPCRDGFGSIMQMAFCPEYVPTFDNVIENITSLTIGKSKYFQDPALLLMHELIHVLHGLYGMQVSSHEIIPSKQEIYMQHTYPISAEELFTFGGQDANLISIDIKNDLYEKTLNDYKAIANKLSQVTSCNDPNIDIDSYKQIYQQKYQFDKDSNGQYIVNEDKFQILYNSIMYGFTEIELGKKFNIKTRLSYFSMNHDPVKIPNLLDDTIYNDTEGFNIESKDLKSEYKGQNMRVNTNAFRNVDGSGLVSKLIGLCKKIIPPTNIRENLYNRTASLTDLGGELCIKIKNEDLTFIAEKNSFSEEPFQDEIVSYNTKNKPLNFNYSLDKIIVDYNLQSKITLPNDRTTPVTKGIPYAPEYKSNAASTIEIHNIDDNTIYQYLYAQKSPTTL
Expression Region: 123-573aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 55.4 kDa
Alternative Name(s): Tentoxylysin
Relevance: Tetanus toxin acts by inhibiting neurotransmitter release. It binds to peripheral neuronal synapses, is internalized and moves by retrograde transport up the axon into the spinal cord where it can move between postsynaptic and presynaptic neurons. It inhibits neurotransmitter release by acting as a zinc endopeptidase that catalyzes the hydrolysis of the '76-Gln-|-Phe-77' bond of synaptobrevin-2.
Reference: Tetanus toxin primary structure, expression in E. coli, and homology with botulinum toxins.Eisel U., Jarausch W., Goretzki K., Henschen A., Engels J., Weller U., Hudel M., Habermann E., Niemann H.EMBO J. 5:2495-2502(1986)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Clostridium tetani Tetanus toxin(tetX),partial
- Regular price
- £537.00 GBP
- Sale price
- £537.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD),partial
- Regular price
- £631.00 GBP
- Sale price
- £631.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Clostridium botulinum Botulinum neurotoxin type D(botD) ,partial
- Regular price
- £692.00 GBP
- Sale price
- £692.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Clostridium botulinum Botulinum neurotoxin type B (botB),partial
- Regular price
- £631.00 GBP
- Sale price
- £631.00 GBP
- Regular price
-
- Unit price
- per
Sold out