Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium phytofermentans UPF0059 membrane protein Cphy_1637 (Cphy_1637)

Recombinant Clostridium phytofermentans UPF0059 membrane protein Cphy_1637 (Cphy_1637)

SKU:CSB-CF431090CWZ

Regular price £1,278.00 GBP
Regular price Sale price £1,278.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)

Uniprot NO.:A9KRD5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLFTLFTLAIGLAMDTFAVSVCKGLAMKKMSLKKAFINGAYFGLFQAGMPIIGYFLGIS FRNYITKIDHWISFVLLVFLGIKMLKEAFDNEACSTNDSVAFRVMIVLAVATSIDALAVG ITFAFLKVNLLLAVSLIGIITFLLSMLGVRLGHVFGARYKRVAECVGGIVLIVLGFKILL EHLGILAQLF

Protein Names:Recommended name: UPF0059 membrane protein Cphy_1637

Gene Names:Ordered Locus Names:Cphy_1637

Expression Region:1-190

Sequence Info:full length protein

View full details