Gene Bio Systems
Recombinant Clostridium pasteurianum Rubredoxin(Rd)
Recombinant Clostridium pasteurianum Rubredoxin(Rd)
SKU:CSB-EP360387CMA
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P00268
Gene Names: Rd
Organism: Clostridium pasteurianum
AA Sequence: MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEE
Expression Region: 1-54aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 22 kDa
Alternative Name(s): Short name:Rd
Relevance: Rubredoxin is a small nonheme, iron protein lacking acid-labile sulfide. Its single Fe, chelated to 4 Cys, functions as an electron acceptor and may also stabilize the conformation of the molecule.
Reference: "Cloning, sequencing and expression in Escherichia coli of the rubredoxin gene from Clostridium pasteurianum."Mathieu I., Meyer J., Moulis J.-M.Biochem. J. 285:255-262(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
