Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clostridium acetobutylicum UPF0059 membrane protein CA_C0950(CA_C0950)

Recombinant Clostridium acetobutylicum UPF0059 membrane protein CA_C0950(CA_C0950)

SKU:CSB-CF847371DUB

Regular price £1,271.00 GBP
Regular price Sale price £1,271.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)

Uniprot NO.:Q97KG9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIYSLFVVAIALSLDAFGVALSIGLDSCVKRKNKLLFAISFGFFQFLCTFIGAYSGFLF NTYITYVPQIIGGMIIAFVGAFMIKEGFDNKEEKLLLNFKMYFVLGISVSIDAAVVGFTM FNKISSNYVILGDSVFIGIVTLILSIIAFIISRYLKRIQLVCKYADYIGGIILVIFGLKM MFF

Protein Names:Recommended name: UPF0059 membrane protein CA_C0950

Gene Names:Ordered Locus Names:CA_C0950

Expression Region:1-183

Sequence Info:full length protein

View full details