Skip to product information
1 of 1

Gene Bio Systems

Recombinant Clavispora lusitaniae Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

Recombinant Clavispora lusitaniae Cytochrome oxidase assembly protein 3, mitochondrial(COA3)

SKU:CSB-CF505529DTX

Regular price £1,068.00 GBP
Regular price Sale price £1,068.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Clavispora lusitaniae (strain ATCC 42720) (Yeast) (Candida lusitaniae)

Uniprot NO.:C4YBX9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAVIGAPKGHNRYRDPKTFQMTPALYRVRKPFFWKNFAGFFLVSSIPLGVYLYTWNVLSK DEFADIPIPPISDEELAKLKKEYESK

Protein Names:Recommended name: Cytochrome oxidase assembly protein 3, mitochondrial

Gene Names:Name:COA3 ORF Names:CLUG_05707

Expression Region:1-86

Sequence Info:full length protein

View full details