Skip to product information
1 of 1

Gene Bio Systems

Recombinant Citrobacter koseri Fumarate reductase subunit D(frdD)

Recombinant Citrobacter koseri Fumarate reductase subunit D(frdD)

SKU:CSB-CF421155CWS

Regular price £1,224.00 GBP
Regular price Sale price £1,224.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Uniprot NO.:A8AMP5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVMVLLVGILLPLGLFPGDALSYERVLAFAQ SFIGRAFLFLMIVLPLWCGLHRMHHAMHDLKIHVPSGKWVFYGLAAILTVVTAIGILTI

Protein Names:Recommended name: Fumarate reductase subunit D Alternative name(s): Fumarate reductase 13 kDa hydrophobic protein

Gene Names:Name:frdD Ordered Locus Names:CKO_03681

Expression Region:1-119

Sequence Info:full length protein

View full details