Gene Bio Systems
Recombinant Citrobacter koseri Fumarate reductase subunit C(frdC)
Recombinant Citrobacter koseri Fumarate reductase subunit C(frdC)
SKU:CSB-CF425293CWS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Uniprot NO.:A8AMP4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTTKRKAYVRPMTSTWWKKLPFYRFYMLREGTAVPAVWFSIELIFGLFALKHGAESWMGF VGFLQNPVVVILNLIALAAALLHTKTWFELAPKAANIIVKDEKMGPEPIIKGLWVVTAVV TVVILYVALYW
Protein Names:Recommended name: Fumarate reductase subunit C Alternative name(s): Fumarate reductase 15 kDa hydrophobic protein
Gene Names:Name:frdC Ordered Locus Names:CKO_03680
Expression Region:1-131
Sequence Info:full length protein
