Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chromohalobacter salexigens UPF0060 membrane protein Csal_2746(Csal_2746)

Recombinant Chromohalobacter salexigens UPF0060 membrane protein Csal_2746(Csal_2746)

SKU:CSB-CF636042CAAK

Regular price £1,191.00 GBP
Regular price Sale price £1,191.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768)

Uniprot NO.:Q1QTW5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLTTTLLFIATAMAEIIGCYLPWLWLRQQGSPWLLVPAAASLTLFVWLLSLHPAASGRVY AAYGGVYVVCALVWLWGVDGEALRPTDWIGAALALTGMGVIASGWR

Protein Names:Recommended name: UPF0060 membrane protein Csal_2746

Gene Names:Ordered Locus Names:Csal_2746

Expression Region:1-106

Sequence Info:full length protein

View full details