Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chromobacterium violaceum ATP synthase subunit a(atpB)

Recombinant Chromobacterium violaceum ATP synthase subunit a(atpB)

SKU:CSB-CF755875CKA

Regular price £1,327.00 GBP
Regular price Sale price £1,327.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

Uniprot NO.:Q7P0A1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASNATDYIKHHLTFWNSDPSAGFWSLHVDTFSISLVLGFLFAAVFAMVARRASIEAPGR LQLFVEMIVELVQTQVREVFHGKSKMIAPLALTIFCWVFLMNFMDLFPVDLFPMAAQWIG YTFFGLEPHHVYFRVVPSADVNATFAMSLSVLILIVGFSIKAKGLGGWGKELLTAPFHSS NPVGAIILAPLNFAFQLVELAAKPISLSLRLFGNLYAGELIFILIALLPWGLQWVLGAPW AIFHILIITLQAFVFMMLTIVYLSLAVEAH

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6

Gene Names:Name:atpB Ordered Locus Names:CV_0666

Expression Region:1-270

Sequence Info:full length protein

View full details