Recombinant Chlorocebus aethiops Membrane cofactor protein(CD46)

SKU: CSB-CF004939DSU

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)

Uniprot NO.:P79138

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CEAPPTFEAMELIGKPKPYYKVGERVDYKCKKGYFYVPPLATHSICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFGSELHFICNEGYYLIGKDILYCELKDTVAVWSGKPPLCEKILCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKGPRPTYKPPVSNYPGYPKPDEGILDSLDDWVIALIVIVIVVAVAVICVALYRFLQGRKKKGKADGGPEYATYQTKSTPPAEQRG

Protein Names:Recommended name: Membrane cofactor protein Alternative name(s): CD_antigen= CD46

Gene Names:Name:CD46 Synonyms:MCP

Expression Region:35-369

Sequence Info:full length protein