Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlorobaculum parvum Photosynthetic reaction center cytochrome c-551(pscC)

Recombinant Chlorobaculum parvum Photosynthetic reaction center cytochrome c-551(pscC)

SKU:CSB-CF463273DSQ

Regular price £1,277.00 GBP
Regular price Sale price £1,277.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlorobaculum parvum (strain NCIB 8327) (Chlorobium vibrioforme subsp. thiosulfatophilum (strain DSM 263 / NCIB 8327))

Uniprot NO.:B3QM18

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDNKSNGKLIALAIGGAVLMGTLFFLVSFLTGYSPAPNHSAILTPLRSFMGWFLLIFCAS LIIMGLGKMSGAISDKWFLSFPLSIFVIVMVMFFSLRFYWEKGRTTTVDGKYIRSVEQLN DFLNKPAATSDLPPVPADFDFAAAEKLTDAKCNKCHTLGSVADLFRTKYKKTGQVKLIVK RMQGFPGANISDDEVIEIGTWLQEKF

Protein Names:Recommended name: Photosynthetic reaction center cytochrome c-551 Short name= Cytochrome c551

Gene Names:Name:pscC Synonyms:cycA Ordered Locus Names:Cpar_0549

Expression Region:1-206

Sequence Info:full length protein

View full details