Recombinant Chlorella vulgaris ATP synthase subunit c, chloroplastic(atpH)

SKU: CSB-CF349970DSP

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlorella vulgaris (Green alga)

Uniprot NO.:P56297

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNPIVAAASVIAAGLAVGLAAIGPGMGQGTAAGYAVEGIARQPEAEGKIRGALLLSFAFM ESLTIYGLVVALALLFANPFAG

Protein Names:Recommended name: ATP synthase subunit c, chloroplastic Alternative name(s): ATP synthase F(0) sector subunit c ATPase subunit III F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpH

Expression Region:1-82

Sequence Info:full length protein