Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chlamydia trachomatis serovar A Sulfur-rich protein(srp)

Recombinant Chlamydia trachomatis serovar A Sulfur-rich protein(srp)

SKU:CSB-CF668571CAAZ

Regular price £1,225.00 GBP
Regular price Sale price £1,225.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlamydia trachomatis serovar A (strain HAR-13 / ATCC VR-571B)

Uniprot NO.:Q3KLQ8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTVPVVQGAGSSNSAQDISTSSAPLTLKERISNLLSSTAFKVGLVVIGLLLVIATLIFL VSAASFVNAIYLVAIPAILGCVNICVGILSMEGHCSPERWILCKKVLKTSEDIIDDGQIN NSNKVFTDERLNAIDGVVESLSRRNSLVDQTQ

Protein Names:Recommended name: Sulfur-rich protein Alternative name(s): Cysteine-rich protein A

Gene Names:Name:srp Synonyms:crpA Ordered Locus Names:CTA_0482

Expression Region:1-152

Sequence Info:full length protein

View full details