Gene Bio Systems
Recombinant Chlamydia trachomatis Probable disulfide formation protein (CT_176)
Recombinant Chlamydia trachomatis Probable disulfide formation protein (CT_176)
SKU:CSB-CF530700DSB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chlamydia trachomatis (strain D/UW-3/Cx)
Uniprot NO.:O84179
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIKHLRSYCLYLAWLFSCIGTLMSVYYSYILNVEPCLLCYYQRICLFPLVVILGIAAYRE DISIKIYTLPLALVGFGIAIYQVCLQEIPGMTLDICGKVSCSTKLFLLGFITMPMASAAA FCAIACLLVLATKSK
Protein Names:Recommended name: Probable disulfide formation protein Alternative name(s): Disulfide oxidoreductase Thiol-disulfide oxidoreductase
Gene Names:Ordered Locus Names:CT_176
Expression Region:1-135
Sequence Info:full length protein
