Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Voltage-gated hydrogen channel 1(HVCN1)

Recombinant Chicken Voltage-gated hydrogen channel 1(HVCN1)

SKU:CSB-CF688710CH

Regular price £1,297.00 GBP
Regular price Sale price £1,297.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5F4C0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSRYLKHFTVVGDDPIQWSNDYQKWENEEEDNGEKDSEIKLEPSRGHVTFQDVMKKLFSS RRFQIVIVFLVIVDALLVLGELLMDLKIIHPDKYHIAPKVFHYLSLSILTIFLVEVGFKI FVYGREFFHHKFEVLDSIVVVVSFILDLVLLFREHEFEAVGLLILLRLWRVARIINGIIL SVKTRSEQQVSKLKQVNLKLATKVEQLQHSCVEKEQEIERLTRMLKQHGLLSEQT

Protein Names:Recommended name: Voltage-gated hydrogen channel 1 Alternative name(s): Hydrogen voltage-gated channel 1 Short name= HV1

Gene Names:Name:HVCN1 ORF Names:RCJMB04_1c7

Expression Region:1-235

Sequence Info:full length protein

View full details