Gene Bio Systems
Recombinant Chicken Transforming growth factor beta-1(TGFB1),partial
Recombinant Chicken Transforming growth factor beta-1(TGFB1),partial
SKU:CSB-EP023446CH
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P09531
Gene Names: TGFB1
Organism: Gallus gallus (Chicken)
AA Sequence: DLDTDYCFGPGTDEKNCCVRPLYIDFRKDLQWKWIHEPKGYMANFCMGPCPYIWSADTQYTKVLALYNQHNPGASAAPCCVPQTLDPLPIIYYVGRNVRVEQLSNMVVRACKCS
Expression Region: 260-373aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 29 kDa
Alternative Name(s):
Relevance: Multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of th have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone rodeling. It is a potent stimulator of osteoblastic bone formation, causing chotaxis, proliferation and differentiation in committed osteoblasts .
Reference: Complementary deoxyribonucleic acid cloning of a messenger ribonucleic acid encoding transforming growth factor beta 4 from chicken embryo chondrocytes.Jakowlew S.B., Dillard P.J., Sporn M.B., Roberts A.B.Mol. Endocrinol. 2:1186-1195(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
