Gene Bio Systems
Recombinant Chicken Oligosaccharyltransferase complex subunit OSTC(OSTC)
Recombinant Chicken Oligosaccharyltransferase complex subunit OSTC(OSTC)
SKU:CSB-CF713729CH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:Q5ZJR3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:METLFRLPFAVLECPNIKLKRPGWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVSVLLSFFMARVFMRMKLPGYLMG
Protein Names:Recommended name: Oligosaccharyltransferase complex subunit OSTC
Gene Names:Name:OSTC ORF Names:RCJMB04_16e19
Expression Region:1-149
Sequence Info:full length protein
