Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Integral membrane protein 2B(ITM2B)

Recombinant Chicken Integral membrane protein 2B(ITM2B)

SKU:CSB-CF011904CH

Regular price £1,347.00 GBP
Regular price Sale price £1,347.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:O42204

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKVSFNSALAHKEAANKEEENSQVLILPPDAKEPEDVVVPAGHKRAWCWCMCFGLAFMLAGVILGGAYLYKYFAFQQGGVYFCGIKYIEDGLSLPESGAQLKSARYHTIEQNIQILEEEDVEFISVPVPEFADSDPADIVHDFHRRLTAYLDLSLDKCYVIPLNTSVVMPPKNFLELLINIKAGTYLPQSYLIHEQMIVTDRIENVDQLGFFIYRLCRGKETYKLQRKEAMKGIQKREAVNCRKIRHFENRFAMETLICEQ

Protein Names:Recommended name: Integral membrane protein 2B Alternative name(s): Transmembrane protein E3-16

Gene Names:Name:ITM2B

Expression Region:1-262

Sequence Info:full length protein

View full details