Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Elongation of very long chain fatty acids protein 6(ELOVL6)

Recombinant Chicken Elongation of very long chain fatty acids protein 6(ELOVL6)

SKU:CSB-CF726504CH

Regular price £1,329.00 GBP
Regular price Sale price £1,329.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:Q5ZJR8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNMSVLTLQEYEFEKQFNEHEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELR KPLVLWSLSLAVFSIFGAVRTAPYMLYILMTKGLKQSVCDQSFYIGPVSKFWAYAFVLSK APELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSY YALRAAGFRVSRKFAMFITLSQITQMLVGCVINYLVFSWMQHGQCHSHVQNIIWSSLMYL SYFVLFCHFFFEAYIGKTTKARKVD

Protein Names:Recommended name: Elongation of very long chain fatty acids protein 6 EC= 2.3.1.n8 Alternative name(s): 3-keto acyl-CoA synthase ELOVL6 ELOVL fatty acid elongase 6 Short name= ELOVL FA elongase 6

Gene Names:Name:ELOVL6 ORF Names:RCJMB04_16d24

Expression Region:1-265

Sequence Info:full length protein

View full details