Skip to product information
1 of 1

Gene Bio Systems

Recombinant Chicken Ectonucleoside triphosphate diphosphohydrolase 5(ENTPD5)

Recombinant Chicken Ectonucleoside triphosphate diphosphohydrolase 5(ENTPD5)

SKU:CSB-CF007694CH

Regular price £1,463.00 GBP
Regular price Sale price £1,463.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Gallus gallus (Chicken)

Uniprot NO.:E1C1L6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTSSRLPVLLALVFSSLSPVLSHSNREMWFQDLFPPNTCPINAKTKTFYGIMFDAGSTGTRIHIYTFVQKSPEILPELEGEIFESVKPGLSAYADQPEKGAESVKRLLDMAIDAVPPHLWKKTPVVLKATAGLRLLSEEKAQALLSEVKEVFEESPFLVPEDSVSIMDGSYEGILAWITVNFLTGQLSGQNQHTVGTLDLGGASTQITFLPRFEETLKESPTDFLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALNTEVADRQMFRSSCLPKQLEAEWHFGGVKYRYGGNKEGETGFKPCYLEVLKVVKGKLHQPDEIRGSSFYAFSYYYDRAADTNLIDYEQGGVLEVRDFERKAKEVCDNMERFSSASPFLCMDLTYITALLKEGFGFRDNTLLQLTKKVNNIETSWTLGATFHLLQSLGITY

Protein Names:Recommended name: Ectonucleoside triphosphate diphosphohydrolase 5 Short name= NTPDase 5 EC= 3.6.1.6 Alternative name(s): Guanosine-diphosphatase ENTPD5 Short name= GDPase ENTPD5 EC= 3.6.1.42 Uridine-diphosphatase ENTPD5 Short name= UDPase ENTPD5

Gene Names:Name:ENTPD5

Expression Region:1-428

Sequence Info:full length protein

View full details