Gene Bio Systems
Recombinant Chicken Ectonucleoside triphosphate diphosphohydrolase 5(ENTPD5)
Recombinant Chicken Ectonucleoside triphosphate diphosphohydrolase 5(ENTPD5)
SKU:CSB-CF007694CH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Gallus gallus (Chicken)
Uniprot NO.:E1C1L6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSSRLPVLLALVFSSLSPVLSHSNREMWFQDLFPPNTCPINAKTKTFYGIMFDAGSTGTRIHIYTFVQKSPEILPELEGEIFESVKPGLSAYADQPEKGAESVKRLLDMAIDAVPPHLWKKTPVVLKATAGLRLLSEEKAQALLSEVKEVFEESPFLVPEDSVSIMDGSYEGILAWITVNFLTGQLSGQNQHTVGTLDLGGASTQITFLPRFEETLKESPTDFLTSFEMFNSTYKLYTHSYLGFGLKAARLATLGALNTEVADRQMFRSSCLPKQLEAEWHFGGVKYRYGGNKEGETGFKPCYLEVLKVVKGKLHQPDEIRGSSFYAFSYYYDRAADTNLIDYEQGGVLEVRDFERKAKEVCDNMERFSSASPFLCMDLTYITALLKEGFGFRDNTLLQLTKKVNNIETSWTLGATFHLLQSLGITY
Protein Names:Recommended name: Ectonucleoside triphosphate diphosphohydrolase 5 Short name= NTPDase 5 EC= 3.6.1.6 Alternative name(s): Guanosine-diphosphatase ENTPD5 Short name= GDPase ENTPD5 EC= 3.6.1.42 Uridine-diphosphatase ENTPD5 Short name= UDPase ENTPD5
Gene Names:Name:ENTPD5
Expression Region:1-428
Sequence Info:full length protein
