Gene Bio Systems
Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog
Recombinant Cercopithecine herpesvirus 1 Envelope protein US9 homolog
SKU:CSB-CF328952CGS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus)
Uniprot NO.:P30025
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEPLRLADAESLLSETSVIPLTPPAQTPEAYYTESDDETAADFLVRMGRQQTAIRRRRRQ TRAAGFVAAFVLVALISGGLGALMCWLAYR
Protein Names:Recommended name: Envelope protein US9 homolog Alternative name(s): 10 kDa protein
Gene Names:
Expression Region:1-90
Sequence Info:full length protein
