Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ceratitis capitata Ribonuclease kappa-B

Recombinant Ceratitis capitata Ribonuclease kappa-B

SKU:CSB-CF770337DRF

Regular price £1,174.00 GBP
Regular price Sale price £1,174.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ceratitis capitata (Mediterranean fruit fly) (Tephritis capitata)

Uniprot NO.:Q7Z0Q2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKICGPKLSLCGLIISVWGIIQLVLMGLFFYINSVALIEDLPIDEEFNSVEEFYTAATSA YNQNAYNCWIAACIYVLTLLLSAQQFYVNSRATAN

Protein Names:Recommended name: Ribonuclease kappa-B Short name= RNase K-B Short name= RNase kappa-B EC= 3.1.-.- Alternative name(s): Cc RNase

Gene Names:

Expression Region:1-95

Sequence Info:full length protein

View full details