Skip to product information
1 of 1

Gene Bio Systems

Recombinant Caulobacter crescentus Flagellar FliL protein(fliL)

Recombinant Caulobacter crescentus Flagellar FliL protein(fliL)

SKU:CSB-CF315566DQO

Regular price £1,270.00 GBP
Regular price Sale price £1,270.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caulobacter crescentus (strain ATCC 19089 / CB15)

Uniprot NO.:P0CG27

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKKPEKEAPAPEGEEGAEGEAPAKKKPPILIIAIAAGVLVLGGGGAAAFFLLKPKPAAE AGEHGEKKEEKKKEKKKEEKGDKKDAEKGAEGAAGTPVIKEGPDGVVFYTLPDIVVNMQT ADGKSTFLKLKLTFELPDEETADELTPNLPRLQDMFQTFLRELRPEDLNGSQGTYQLRVE LLRRVNLVAAPAKVNAVLIEEMLIN

Protein Names:Recommended name: Flagellar FliL protein

Gene Names:Name:fliL Ordered Locus Names:CC_2062

Expression Region:1-205

Sequence Info:full length protein

View full details