Skip to product information
1 of 1

Gene Bio Systems

Recombinant Cat Bladder cancer-associated protein(BLCAP)

Recombinant Cat Bladder cancer-associated protein(BLCAP)

SKU:CSB-CF002712CA

Regular price £1,069.00 GBP
Regular price Sale price £1,069.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Felis catus (Cat) (Felis silvestris catus)

Uniprot NO.:P62953

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYS CWGNCFLYHCSDSPLPESAHDPGVVGT

Protein Names:Recommended name: Bladder cancer-associated protein Alternative name(s): Bladder cancer 10 kDa protein Short name= Bc10

Gene Names:Name:BLCAP Synonyms:BC10

Expression Region:1-87

Sequence Info:Full length protein

View full details