Gene Bio Systems
Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B
Recombinant Carpinus betulus Major pollen allergen Car b 1 isoforms 1A and 1B
SKU:CSB-EP330956CEC
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P38949
Gene Names: N/A
Organism: Carpinus betulus (European hornbeam) (Carpinus caucasica)
AA Sequence: GVFNYEAETPSVIPAARLFKSYVLDGDKLIPKVAPQVISSVENVGGNGGPGTIKNITFAEGIPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSKFHAKGYHEVNAEKMKGAKEMAEKLLRAVESYLLAHTAEYN
Expression Region: 2-160aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 21.3 kDa
Alternative Name(s):
Relevance:
Reference: PCR based cloning and sequencing of isogenes encoding the tree pollen major allergen Car b I from Carpinus betulus, hornbeam.Nedergaard Larsen J., Stroeman P., Ipsen H.Mol. Immunol. 29:703-711(1992)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
