Skip to product information
1 of 1

Gene Bio Systems

Recombinant Capsicum annuum CASP-like protein PIMP1(PIMP1)

Recombinant Capsicum annuum CASP-like protein PIMP1(PIMP1)

SKU:CSB-CF381757DQD

Regular price £1,237.00 GBP
Regular price Sale price £1,237.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Capsicum annuum (Bell pepper)

Uniprot NO.:A1XGB4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTPPPTSTVPPYVSLIVRILTLICLLISFIVIATNNQTVSTVAGDVKIKFKDFYAYRYLI ATVIIGMAYTLLQIAFSISLLTTGNRIGGEGFLLFDFYGDKFISYFLVTGAAASFGMTQD LKQLEGSDNYSKFLNTSNAAASLCLIGFFFAVASSIFSSYNLPKRI

Protein Names:Recommended name: CASP-like protein PIMP1 Alternative name(s): Pathogen-induced membrane protein 1 Short name= CaPIMP1

Gene Names:Name:PIMP1

Expression Region:1-166

Sequence Info:full length protein

View full details