Recombinant Canine coronavirus Non-structural protein 7a(7a)

SKU: CSB-CF742484CHAH

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Canine coronavirus (strain BGF10) (CCoV) (Canine enteric coronavirus)

Uniprot NO.:Q7T6S7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LERLLLNHSLNLKTVNNVLGVTDTGLKVNCLQLLKPDCLDFNILYRSLAETRLLKVVLRV IFLVLLGFCCHRLLVTLF

Protein Names:Recommended name: Non-structural protein 7a Short name= ns7a Alternative name(s): 11 kDa protein Accessory protein 7a X3 protein

Gene Names:ORF Names:7a

Expression Region:24-101

Sequence Info:full length protein