Skip to product information
1 of 1

Gene Bio Systems

Recombinant Candida tropicalis Cytochrome b5(Cytb5)

Recombinant Candida tropicalis Cytochrome b5(Cytb5)

SKU:CSB-CF801282CZN

Regular price £1,230.00 GBP
Regular price Sale price £1,230.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Candida tropicalis (Yeast)

Uniprot NO.:Q874I5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTDTDTTTTIYTHEEVAQHTTHDDLWVILNGKVYNISNYIDEHPGGEEVILDCAGTDATE AFDDIGHSDEAHEILEKLYIGNLKGAKIVEAKHAQSFSTEEDSGINFPLIAVGVFLAAFG VYYYKTNFA

Protein Names:Recommended name: Cytochrome b5

Gene Names:Name:Cytb5

Expression Region:1-129

Sequence Info:full length protein

View full details