Gene Bio Systems
Recombinant Candida albicans ATP synthase subunit 9, mitochondrial(ATP9)
Recombinant Candida albicans ATP synthase subunit 9, mitochondrial(ATP9)
SKU:CSB-CF858354CZD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)
Uniprot NO.:Q9B8D5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQLALAAKYIGASIATLGLGGAAIGIALVFVALINGTSRNPSLRSTLFPQAILGFALSEA CGLFCLMISFLLLYAV
Protein Names:Recommended name: ATP synthase subunit 9, mitochondrial Alternative name(s): Lipid-binding protein
Gene Names:Name:ATP9 ORF Names:CaalfMp05
Expression Region:1-76
Sequence Info:full length protein
