Skip to product information
1 of 1

Gene Bio Systems

Recombinant Caenorhabditis briggsae Golgi SNAP receptor complex member 1(gos-28)

Recombinant Caenorhabditis briggsae Golgi SNAP receptor complex member 1(gos-28)

SKU:CSB-CF009677CXX

Regular price £1,320.00 GBP
Regular price Sale price £1,320.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Caenorhabditis briggsae

Uniprot NO.:A8XLW0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSETWEALRKKARSTENSIDVKLVSLNKLTASSHGGFDIDEKTVSSRQTTFRTVTTEIEGLIEQLTNINDDMNDVAGAQSSASWASNPAIQHTLRRHREILRDYGSEYRRARDNVDQVLQRELLLSSSNNESRNPAVNNRARGYDMYLKENDHINACDRLLDEQIEMAMSTKENVARQGINLRGISNRLHYITKKYPAINNLMQKIKTKKQKNTMILAGVISACLIFTIFWIIN

Protein Names:Recommended name: Golgi SNAP receptor complex member 1 Alternative name(s): 28 kDa Golgi SNARE protein Short name= GOS-28

Gene Names:Name:gos-28 Synonyms:gosr-1, gs28 ORF Names:CBG15298

Expression Region:1-234

Sequence Info:full length protein

View full details