Gene Bio Systems
Recombinant Burkholderia sp. Probable intracellular septation protein A(Bcep18194_A5211)
Recombinant Burkholderia sp. Probable intracellular septation protein A(Bcep18194_A5211)
SKU:CSB-CF667758BAAK
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Burkholderia sp. (strain 383) (Burkholderia cepacia (strain ATCC 17760 / NCIB 9086 / R18194))
Uniprot NO.:Q39FG1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKFLFDLFPIILFFAAFKVWGIFTATAVAIVATLAQVAWVAFRHRKVDTMLWVSLGVIVV FGGATLVLHDEKFIQWKPTVLYWLFAIGLLAARYAFGNNLIEKMMGKQLTLPHPVWDKLN VAWALFFAVLGVANLYVVHNFTESQWVNFKLFGTTGAMVVFIILQSLWLTKYLKDE
Protein Names:Recommended name: Probable intracellular septation protein A
Gene Names:Ordered Locus Names:Bcep18194_A5211
Expression Region:1-176
Sequence Info:full length protein
