Skip to product information
1 of 1

Gene Bio Systems

Recombinant Burkholderia ambifaria UPF0060 membrane protein Bamb_1160(Bamb_1160)

Recombinant Burkholderia ambifaria UPF0060 membrane protein Bamb_1160(Bamb_1160)

SKU:CSB-CF601604BAAF

Regular price £1,194.00 GBP
Regular price Sale price £1,194.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD))

Uniprot NO.:Q0BGK5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTELMKIAALFAVTALAEIVGCYLPWLVLKGGRPVWLLVPAALSLALFAWLLTLHPSAAG RTYAAYGGVYIAVALIWLRVVDGVALTRWDAAGAVLALGGMAVIALQPRA

Protein Names:Recommended name: UPF0060 membrane protein Bamb_1160

Gene Names:Ordered Locus Names:Bamb_1160

Expression Region:1-110

Sequence Info:full length protein

View full details