Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bufo marinus Sodium-potassium-transporting ATPase subunit beta-3

Recombinant Bufo marinus Sodium-potassium-transporting ATPase subunit beta-3

SKU:CSB-CF002328BXI

Regular price £1,353.00 GBP
Regular price Sale price £1,353.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bufo marinus (Giant toad) (Cane toad)

Uniprot NO.:P30716

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAKEENKSGEQSSSEWKQFIYNPSSGEILGRTASSWALILLFYLVFYGFLAGLFTLTMWVMLQTLDDSVPKYRDRVSFPGLMISPKSAGLEISFSKSDKSHMKSILKFFTHFYHHTMTPYKLQMCSARKAITTEQEGVEEKKSCQFNRSSLGPCAGLEGNEYFGYNDGSPCVLVKMNRIIGLKPDGNPHINCTSKAENISLQYYPEYGKIDLMYYPYYGKKTHVNYVQPLVAVKITPSNSTGTSEIVLECKLYGSPNLKNNDDRDKFLGRVNFKLEIKD

Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-3 Alternative name(s): Sodium/potassium-dependent ATPase beta-3 subunit

Gene Names:

Expression Region:1-279

Sequence Info:full length protein

View full details