Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0070 protein BUsg_583 (BUsg_583)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0070 protein BUsg_583 (BUsg_583)

SKU:CSB-CF527477BXE

Regular price £1,267.00 GBP
Regular price Sale price £1,267.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Uniprot NO.:O51880

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHLNKMKKVSLKTYLVLFFLIFFIFCSFWFIKPKEKKLKLEKLRYEEVIKKINAKNNQNL KSVENFITENKNIYGTLSSLFLAKKYILDKNLDKALIQLNNSLKYTKEENLQNILKIRIA KIKIQQNKNQDAIKILEEIKDNSWKNIVENMKGDIFMKNKEIKKAILAWKKSKYLEKSNA SKEIINMKINEIKR

Protein Names:Recommended name: UPF0070 protein BUsg_583

Gene Names:Ordered Locus Names:BUsg_583

Expression Region:1-194

Sequence Info:full length protein

View full details