Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0056 membrane protein BUsg_257(BUsg_257)

Recombinant Buchnera aphidicola subsp. Schizaphis graminum UPF0056 membrane protein BUsg_257(BUsg_257)

SKU:CSB-CF813047BXE

Regular price £1,297.00 GBP
Regular price Sale price £1,297.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

Uniprot NO.:Q8K9Q4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHISMFDFSIYIKFFVSLCALVNPIGMIPIFTTMTNHQSHLERKKTNLVANFSAFIILLI SLFAGNSILNAFGISINSFRIAGGILIISIAFSMISGKFTKNNKTSKEKNQENISVVPLA MPLIAGPGAISSTIVWSTYYSTWSDFLGCSIAIFLFAFVCWLCFRAAPCVVEILGKTGIN IITRIMGLLLMSLGIEFLSIGIKSIFSALLH

Protein Names:Recommended name: UPF0056 membrane protein BUsg_257

Gene Names:Ordered Locus Names:BUsg_257

Expression Region:1-211

Sequence Info:full length protein

View full details