Skip to product information
1 of 1

Gene Bio Systems

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Colicin V production protein homolog(cvpA)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Colicin V production protein homolog(cvpA)

SKU:CSB-CF804162BMZ

Regular price £1,239.00 GBP
Regular price Sale price £1,239.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Uniprot NO.:Q89AT1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNVIDCISIIVIIISAVISFFRGFLQELSSIFIWIVGVCVFFRYYSFFSIFSTYVRNIFL KNIISYIVFFVFFLFFKSIFDYCIIIFIEKCGISLINKIFGMFFGIIRGVLFLCIVLFFL ELLTNFAYNKYFKNSFFVPYFNCFIKVVIKYLFKKYILFKS

Protein Names:Recommended name: Colicin V production protein homolog

Gene Names:Name:cvpA Ordered Locus Names:bbp_158

Expression Region:1-161

Sequence Info:full length protein

View full details