Gene Bio Systems
Recombinant Brucella melitensis biotype 1 Sulfoxide reductase heme-binding subunit YedZ(yedZ)
Recombinant Brucella melitensis biotype 1 Sulfoxide reductase heme-binding subunit YedZ(yedZ)
SKU:CSB-CF820487BMO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Uniprot NO.:Q8YD73
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAAATGTRKKKTPRPGQWKLWLLYTAGFVPAVWTFYLGATGQLGADPVKTFEHLLGLWAL RFLILTLLVTPMRDLTGITLLRYRRALGLLAFYYALMHFTTYMVLDQGLNLSAIITDIVR RPFITIGMISLALLVPLALTSNNWSIRKLGRRWSSLHKLVYIAIAGSAVHFLMSVKSWPA EPVIYAAIVAALLLWRLARPYLRTRKPALRPRGEAIALRK
Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ
Gene Names:Name:yedZ Ordered Locus Names:BMEII0304
Expression Region:1-220
Sequence Info:full length protein
